FOXO4-DRI (10 mg)

FOXO4-DRI is a synthetic peptide designed to selectively induce apoptosis in senescent cells, which are cells that have stopped dividing but remain metabolically active. These cells contribute to aging and various age-related diseases through their pro-inflammatory secretions, known as the senescence-associated secretory phenotype (SASP).

$274.97

Availability: In stock

Don't forget your BAC Water

Glass vial of Biolongevity Labs Reconstitution Solution, 30ml, containing deionized pure water and .9% benzyl alcohol, made in the USA.
Reconstitution Solution (30ml) (BAC Water)
$19.97
- +
Buy in bulk and save (not applicable with other sales)
SKU FOXO-10MG Category Tag Brand:

FOXO4-DRI Peptide Description

FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.

Peptide Information

Property Value
Peptide Sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids)
Molecular Formula C228H388N86O64
Molecular Weight 5358 g/mol
CAS Number 2460055-10-9
Synonyms Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431

FOXO4-D-Retro-Inverso Structure

FOXO4 Structure | FOXO4-DRI (10 mg)

Source: Uniprot

Product Usage:

This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY.ย This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only.ย  This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.

Weight 0.250 oz
Dimensions 0.625 × 0.625 × 1.5 in
Dutify Classification ID

6064

99%+ Purity, Third Party Tested

Independently verified by three separate certified laboratories. COAs available pre-purchase.

GMP Manufacturing Standards

Synthesized in USA-registered facilities following Good Manufacturing Practices. Full chain of custody documentation.

Best In Class Fulfillment

Same-day shipping on orders before 12 PM PT. Free standard domestic shipping on orders over $400.

Zero Fillers or Additives

Pure active compounds only. Independently verified composition for reliable in vitro studies.

Scientific Reviewer

Scientifically reviewed by Dr. Ky H. Le, MD. Dr. Le is a board-certified family medicine physician with over 20 years of clinical experience. Dr. Le validates the scientific accuracy of all technical content and research citations.

Disclaimer: For Research Purposes Only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use in humans. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.
Glass vial with rubber cap labeled FOXO4-DRI 10MG 99% Purity from Biolongevity Labs.FOXO4-DRI (10 mg)
$274.97

Availability: In stock

Don't forget your BAC Water

Glass vial of Biolongevity Labs Reconstitution Solution, 30ml, containing deionized pure water and .9% benzyl alcohol, made in the USA.
Reconstitution Solution (30ml) (BAC Water)
$19.97
- +