Cagrilintide Description
Cagrilintide is a novel long-acting amylin analog featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.
Peptide Information
| Property | Value |
|---|---|
| Peptide Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular Formula | C194H312N54O59S2 |
| Molecular Weight | 4409 g/mol |
| CAS Number | 1415456-99-3 |
| PubChem CID | 171397054 |
| Synonyms | 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N |
Cagrilintide Peptide Structure
Source: PubChem
Lyophilized Peptides:
Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.
Product Usage:
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY.ย This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only.ย This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug.
